PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00345.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family G2-like
Protein Properties Length: 362aa    MW: 40182.7 Da    PI: 6.3529
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00345.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like84.98.2e-27126180155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    ++r+rWtpeLH+ F+eav+ LGG e+AtPk+il +m+v gL +++vkSHLQk Rl
  Jcr4S00345.20 126 RQRMRWTPELHDLFLEAVKTLGGLENATPKKILGIMNVVGLNIDQVKSHLQKCRL 180
                    58**************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.102123183IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.8E-25124181IPR009057Homeodomain-like
SuperFamilySSF466891.63E-15124181IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-22127181IPR006447Myb domain, plants
PfamPF002494.4E-8128178IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MRTSGINSLD SAFLLDGELP VESDNYDSTT WLDFLDIPVE SSVGSFPSLQ QANENSRMIE  60
KMGIEIPHDK DTGNPAPAEI FEVPRMSLIP VIDLDCKKTH RSSFGRKDNS AAYFDYGVPQ  120
AETSYRQRMR WTPELHDLFL EAVKTLGGLE NATPKKILGI MNVVGLNIDQ VKSHLQKCRL  180
AKNLSDQKHD RKASSVEKNA ACLNKDSEAT SKSDIEVLES LNIQIEAQKL LHEQIEVPFS  240
SLIFLLPKLF LNCATATLLV PSSATLLVSS LGPAMLHTGG AQRELQLRIQ QNVELLKKLM  300
EEQQQNAIPK PIHDVPTSIS NCDQLSPSSS RPVINYCSAS QPSTHEATKN HLKSNKRLRG  360
EQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012084309.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A067JUY90.0A0A067JUY9_JATCU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1703558
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.22e-30G2-like family protein